Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | RNA-directed RNA polymerase |
---|
Ligand | BDBM384110 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Measurement of Interferon Production in Human PBMC |
---|
EC50 | 1270±n/a nM |
---|
Citation | Bonfanti, J; Doublet, FM; Embrechts, W; Fortin, JM; McGowan, DC; Muller, P; Raboisson, PJ Purine derivatives for the treatment of viral infections US Patent US10280167 Publication Date 5/7/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
RNA-directed RNA polymerase |
---|
Name: | RNA-directed RNA polymerase |
Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
Type: | Protein |
Mol. Mass.: | 25173.95 |
Organism: | Hepatitis C virus |
Description: | Q8JXU8 |
Residue: | 229 |
Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
BDBM384110 |
---|
n/a |
---|
Name | BDBM384110 |
Synonyms: | US10280167, Example 55 |
Type | Small organic molecule |
Emp. Form. | C19H19N9O2 |
Mol. Mass. | 405.4133 |
SMILES | Nc1nc(nc2n(Cc3cccc(c3)C(=O)N3CCCC3)c(=O)[nH]c12)-c1nnc[nH]1 |
Structure |
|