Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM26676 |
---|
Substrate/Competitor | Calf Thymus Histone |
---|
Meas. Tech. | Radioactive Filter Plate Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 296.15±n/a K |
---|
IC50 | 430±n/a nM |
---|
Citation | Cheney, IW; Yan, S; Appleby, T; Walker, H; Vo, T; Yao, N; Hamatake, R; Hong, Z; Wu, JZ Identification and structure-activity relationships of substituted pyridones as inhibitors of Pim-1 kinase. Bioorg Med Chem Lett17:1679-83 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM26676 |
---|
Calf Thymus Histone |
---|
Name: | Calf Thymus Histone |
Synonyms: | n/a |
Type: | Other Protein Type |
Mol. Mass.: | 358.43 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 3 |
Sequence: | |