| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [342-460] |
|---|
| Ligand | BDBM391508 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | BRD4 AlphaScreen Assay |
|---|
| IC50 | <100±n/a nM |
|---|
| Citation |  Combs, AP; Maduskuie, Jr., TP; Falahatpisheh, N 1H-pyrrolo[2,3,c]pyridin-7(6H)-ones and pyrazolo[3,4-c]pyridin-7(6H)-ones as inhibitors of BET proteins US Patent US9957268 Publication Date 5/1/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [342-460] |
|---|
| Name: | Bromodomain-containing protein 4 [342-460] |
|---|
| Synonyms: | BRD4 | BRD4-BD2 (aa 342-460) | BRD4_HUMAN | Bromodomain containing 4 (aa 342-460) | Bromodomain-containing protein 4 (BRD4)(BD2) | HUNK1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13783.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | a.a. 342-460 (BRD4-BD2) |
|---|
| Residue: | 119 |
|---|
| Sequence: | PAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMS
TIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
|
|
|
|---|
| BDBM391508 |
|---|
| n/a |
|---|
| Name | BDBM391508 |
|---|
| Synonyms: | US10472358, Example 8 | US10781209, Example 8 | US11059821, Example 8 | US11702416, Example 8 | US9957268, Example 8 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H19N3O3 |
|---|
| Mol. Mass. | 337.3725 |
|---|
| SMILES | CCC1Oc2c(cccc2-c2cn(C)c(=O)c3[nH]ccc23)N(C)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
