Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM31806 |
---|
Substrate/Competitor | Bak-BH3 peptide |
---|
Meas. Tech. | Fluorescence Polarization Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 296.15±n/a K |
---|
IC50 | 6300±n/a nM |
---|
Citation | Wei, J; Kitada, S; Rega, MF; Stebbins, JL; Zhai, D; Cellitti, J; Yuan, H; Emdadi, A; Dahl, R; Zhang, Z; Yang, L; Reed, JC; Pellecchia, M Apogossypol derivatives as pan-active inhibitors of antiapoptotic B-cell lymphoma/leukemia-2 (Bcl-2) family proteins. J Med Chem52:4511-23 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
Type: | Mitochondrion membrane; Single-pass membrane protein |
Mol. Mass.: | 26039.60 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM31806 |
---|
Bak-BH3 peptide |
---|
Name: | Bak-BH3 peptide |
Synonyms: | F-BakBH3 |
Type: | Fluorescein-labeled peptide |
Mol. Mass.: | 1724.92 |
Organism: | n/a |
Description: | Derived from human apoptosis regulator BAK (residues 72-87). |
Residue: | 16 |
Sequence: | |