Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Vasopressin V2 receptor |
---|
Ligand | BDBM35677 |
---|
Substrate/Competitor | BDBM35667 |
---|
Meas. Tech. | Binding Assay for Human V2 Receptor |
---|
pH | 7.4±n/a |
---|
Temperature | 296.15±n/a K |
---|
Ki | 5.6±n/a nM |
---|
Citation | Tsukamoto, I; Koshio, H; Kuramochi, T; Saitoh, C; Yanai-Inamura, H; Kitada-Nozawa, C; Yamamoto, E; Yatsu, T; Shimada, Y; Sakamoto, S; Tsukamoto, S Synthesis and structure-activity relationships of amide derivatives of (4,4-difluoro-1,2,3,4-tetrahydro-5H-1-benzazepin-5-ylidene)acetic acid as selective arginine vasopressin V2 receptor agonists. Bioorg Med Chem17:3130-41 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Vasopressin V2 receptor |
---|
Name: | Vasopressin V2 receptor |
Synonyms: | ADHR | AVPR V2 | AVPR2 | Antidiuretic hormone receptor | DIR | DIR3 | Renal-type arginine vasopressin receptor | V2R | V2R_HUMAN | VASOPRESSIN V2 | Vasopressin V2 receptor | Vasopressin receptor |
Type: | Receptor |
Mol. Mass.: | 40295.28 |
Organism: | Homo sapiens (Human) |
Description: | P30518 |
Residue: | 371 |
Sequence: | MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
|
|
|
BDBM35677 |
---|
BDBM35667 |
---|
Name | BDBM35677 |
Synonyms: | 5H-1-benzazepin-5-ylidene acetamide, 1e |
Type | Small organic molecule |
Emp. Form. | C30H26ClF2N5O2 |
Mol. Mass. | 562.01 |
SMILES | Cc1ccn(n1)-c1ccc(C(=O)N2CCC(F)(F)\C(=C/C(=O)NCc3cccc(C)n3)c3ccccc23)c(Cl)c1 |
Structure |
|