| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase |
|---|
| Ligand | BDBM83263 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) |
|---|
| IC50 | 3709±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Beta-lactamase |
|---|
| Name: | Beta-lactamase |
|---|
| Synonyms: | Beta lactamase |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 31513.38 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | gi_114881106 |
|---|
| Residue: | 286 |
|---|
| Sequence: | MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
|
|
|
|---|
| BDBM83263 |
|---|
| n/a |
|---|
| Name | BDBM83263 |
|---|
| Synonyms: | MLS001065937 | N-butyl-2-(4-cyclohexylsulfanylphenyl)imidazo[1,2-a]pyrazin-3-amine | N-butyl-2-[4-(cyclohexylthio)phenyl]-3-imidazo[1,2-a]pyrazinamine | SMR000814582 | butyl-[2-[4-(cyclohexylthio)phenyl]imidazo[1,2-a]pyrazin-3-yl]amine | cid_42601124 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28N4S |
|---|
| Mol. Mass. | 380.55 |
|---|
| SMILES | CCCCNc1c(nc2cnccn12)-c1ccc(SC2CCCCC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
