Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | dCTP pyrophosphatase 1 |
---|
Ligand | BDBM50260219 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1693435 |
---|
IC50 | 2200±n/a nM |
---|
Citation | Llona-Minguez, S; Häggblad, M; Martens, U; Johansson, L; Sigmundsson, K; Lundbäck, T; Loseva, O; Jemth, AS; Lundgren, B; Jensen, AJ; Scobie, M; Helleday, T Diverse heterocyclic scaffolds as dCTP pyrophosphatase 1 inhibitors. Part 2: Pyridone- and pyrimidinone-derived systems. Bioorg Med Chem Lett27:3219-3225 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
dCTP pyrophosphatase 1 |
---|
Name: | dCTP pyrophosphatase 1 |
Synonyms: | DCTP1_HUMAN | DCTPP1 | Deoxycytidine-triphosphatase 1 | XTP3TPA | dCTP pyrophosphatase 1 | dCTP pyrophosphatase 1 (DCTPP1) |
Type: | Protein |
Mol. Mass.: | 18673.58 |
Organism: | Homo sapiens (Human) |
Description: | Q9H773 |
Residue: | 170 |
Sequence: | MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
VGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLS
KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
|
|
|
BDBM50260219 |
---|
n/a |
---|
Name | BDBM50260219 |
Synonyms: | CHEMBL4095961 |
Type | Small organic molecule |
Emp. Form. | C15H13ClN4O2S |
Mol. Mass. | 348.807 |
SMILES | CC(C)c1nn2c(ncc(NC(=O)c3ccccc3Cl)c2=O)s1 |
Structure |
|