Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50273913 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1713601 (CHEMBL4123650) |
---|
EC50 | 90±n/a nM |
---|
Citation | Naidu, BN; Walker, MA; Sorenson, ME; Ueda, Y; Matiskella, JD; Connolly, TP; Dicker, IB; Lin, Z; Bollini, S; Terry, BJ; Higley, H; Zheng, M; Parker, DD; Wu, D; Adams, S; Krystal, MR; Meanwell, NA The discovery and preclinical evaluation of BMS-707035, a potent HIV-1 integrase strand transfer inhibitor. Bioorg Med Chem Lett28:2124-2130 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50273913 |
---|
n/a |
---|
Name | BDBM50273913 |
Synonyms: | CHEMBL4127663 |
Type | Small organic molecule |
Emp. Form. | C18H20FN3O4 |
Mol. Mass. | 361.3675 |
SMILES | Cc1cc(CNC(=O)c2nc3n(CCOC3(C)C)c(=O)c2O)ccc1F |
Structure |
|