| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50014153 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159470 |
|---|
| IC50 | 280±n/a nM |
|---|
| Citation |  Kempf, DJ; Norbeck, DW; Codacovi, L; Wang, XC; Kohlbrenner, WE; Wideburg, NE; Paul, DA; Knigge, MF; Vasavanonda, S; Craig-Kennard, A Structure-based, C2 symmetric inhibitors of HIV protease. J Med Chem33:2687-9 (1990) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50014153 |
|---|
| n/a |
|---|
| Name | BDBM50014153 |
|---|
| Synonyms: | ((1S,2S,3S,4S)-1-Benzyl-4-tert-butoxycarbonylamino-2,3-dihydroxy-5-phenyl-pentyl)-carbamic acid tert-butyl ester | CHEMBL9726 | di-tert-butyl ((2S,3S,4S,5S)-3,4-dihydroxy-1,6-diphenylhexane-2,5-diyl)dicarbamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H40N2O6 |
|---|
| Mol. Mass. | 500.627 |
|---|
| SMILES | CC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)OC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
