| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM50260103 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1721406 (CHEMBL4136406) |
|---|
| Ki | 260±n/a nM |
|---|
| Citation |  Nocentini, A; Cadoni, R; Del Prete, S; Capasso, C; Dumy, P; Gratteri, P; Supuran, CT; Winum, JY Benzoxaboroles as Efficient Inhibitors of the ?-Carbonic Anhydrases from Pathogenic Fungi: Activity and Modeling Study. ACS Med Chem Lett8:1194-1198 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | n/a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24709.64 |
|---|
| Organism: | Candida glabrata |
|---|
| Description: | ChEMBL_584597 |
|---|
| Residue: | 219 |
|---|
| Sequence: | MTKDTIFTLTGKCALDNILDANRQWAQAMHRSQPQLFPTNGQGQDPHTLFIGCSDSRYNE
DCLGVLPGEIFTLKTVANICHTDDHSLLATLEFAILNLKVNRIILCGHTDCGGIKTCLLG
RESIKESCPHLYEHLDDIEDLVESHESELNQLDNICSKSKLMSHRNVERQLQRLLQIPVV
QDALRNSNQDHEFNIFGLVYNVDSGLVDVVREVYGNQQK
|
|
|
|---|
| BDBM50260103 |
|---|
| n/a |
|---|
| Name | BDBM50260103 |
|---|
| Synonyms: | Benzo[C][1,2]Oxaborol-1(3H)-Ol | Benzoxaborole | CHEBI:78238 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H7BO2 |
|---|
| Mol. Mass. | 133.94 |
|---|
| SMILES | OB1OCc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
