Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50017082 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_146777 |
---|
IC50 | 6±n/a nM |
---|
Citation | Kim, CH; Rothman, RB; Jacobson, AE; Mattson, MV; Bykov, V; Streaty, RA; Klee, WA; George, C; Long, JB; Rice, KC Probes for narcotic receptor mediated phenomena. 15. (3S,4S)-(+)-trans-3-methylfentanyl isothiocyanate, a potent site-directed acylating agent for the delta opioid receptors in vitro. J Med Chem32:1392-8 (1989) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50017082 |
---|
n/a |
---|
Name | BDBM50017082 |
Synonyms: | (+)-trans-N-{1-[2-(4-Isothiocyanato-phenyl)-ethyl]-3-methyl-piperidin-4-yl}-N-phenyl-propionamide | (+)cis-N-{1-[2-(4-Isothiocyanato-phenyl)-ethyl]-3-methyl-piperidin-4-yl}-N-phenyl-propionamide | (-)-trans-N-{1-[2-(4-Isothiocyanato-phenyl)-ethyl]-3-methyl-piperidin-4-yl}-N-phenyl-propionamide | (-)cis-N-{1-[2-(4-Isothiocyanato-phenyl)-ethyl]-3-methyl-piperidin-4-yl}-N-phenyl-propionamide | CHEMBL11968 |
Type | Small organic molecule |
Emp. Form. | C24H29N3OS |
Mol. Mass. | 407.572 |
SMILES | CCC(=O)N([C@H]1CCN(CCc2ccc(cc2)N=C=S)C[C@H]1C)c1ccccc1 |
Structure |
|