Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Group 10 secretory phospholipase A2 |
---|
Ligand | BDBM50366840 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1735577 (CHEMBL4151113) |
---|
IC50 | 110±n/a nM |
---|
Citation | Knerr, L; Giordanetto, F; Nordberg, P; Pettersen, D; Selmi, N; Beisel, HG; de la Motte, H; Olsson, T; Perkins, TDJ; Herslöf, M; Månsson, Å; Dahlström, M; Starke, I; Broddefalk, J; Saarinen, G; Klingegård, F; Hurt-Camejo, E; Rosengren, B; Brengdahl, J; Jansen, F; Rohman, M; Sandmark, J; Hallberg, K; Åkerud, T; Roth, RG; Ahlqvist, M Discovery of a Series of Indole-2 Carboxamides as Selective Secreted Phospholipase A ACS Med Chem Lett9:594-599 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Group 10 secretory phospholipase A2 |
---|
Name: | Group 10 secretory phospholipase A2 |
Synonyms: | Group X secretory phospholipase A2 | PA2GX_HUMAN | PLA2G10 |
Type: | PROTEIN |
Mol. Mass.: | 18153.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1442449 |
Residue: | 165 |
Sequence: | MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPI
AYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGP
AENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
|
|
|
BDBM50366840 |
---|
n/a |
---|
Name | BDBM50366840 |
Synonyms: | CHEMBL4174522 |
Type | Small organic molecule |
Emp. Form. | C19H15N3O3 |
Mol. Mass. | 333.3407 |
SMILES | NC(=O)c1cc2ccc(cc2n1-c1cccc(CCC(O)=O)c1)C#N |
Structure |
|