Reaction Details |
| Report a problem with these data |
Target | Stromal cell-derived factor 1 |
---|
Ligand | BDBM50369275 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1736458 (CHEMBL4151994) |
---|
Ki | >10000±n/a nM |
---|
Citation | Regenass, P; Abboud, D; Daubeuf, F; Lehalle, C; Gizzi, P; Riché, S; Hachet-Haas, M; Rohmer, F; Gasparik, V; Boeglin, D; Haiech, J; Knehans, T; Rognan, D; Heissler, D; Marsol, C; Villa, P; Galzi, JL; Hibert, M; Frossard, N; Bonnet, D Discovery of a Locally and Orally Active CXCL12 Neutraligand (LIT-927) with Anti-inflammatory Effect in a Murine Model of Allergic Airway Hypereosinophilia. J Med Chem61:7671-7686 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Stromal cell-derived factor 1 |
---|
Name: | Stromal cell-derived factor 1 |
Synonyms: | CXCL12 | Chemokine CXCL12 | SDF1 | SDF1A | SDF1B | SDF1_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 10677.83 |
Organism: | Homo sapiens (Human) |
Description: | P48061 |
Residue: | 93 |
Sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
|
|
|
BDBM50369275 |
---|
n/a |
---|
Name | BDBM50369275 |
Synonyms: | CHEMBL4162758 |
Type | Small organic molecule |
Emp. Form. | C17H15ClO3 |
Mol. Mass. | 302.752 |
SMILES | COc1cc(ccc1O)C(\C)=C\C(=O)c1ccc(Cl)cc1 |
Structure |
|