| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Stromal cell-derived factor 1 |
|---|
| Ligand | BDBM50369279 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1736474 (CHEMBL4152010) |
|---|
| Kd | 780±n/a nM |
|---|
| Citation |  Regenass, P; Abboud, D; Daubeuf, F; Lehalle, C; Gizzi, P; Riché, S; Hachet-Haas, M; Rohmer, F; Gasparik, V; Boeglin, D; Haiech, J; Knehans, T; Rognan, D; Heissler, D; Marsol, C; Villa, P; Galzi, JL; Hibert, M; Frossard, N; Bonnet, D Discovery of a Locally and Orally Active CXCL12 Neutraligand (LIT-927) with Anti-inflammatory Effect in a Murine Model of Allergic Airway Hypereosinophilia. J Med Chem61:7671-7686 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Stromal cell-derived factor 1 |
|---|
| Name: | Stromal cell-derived factor 1 |
|---|
| Synonyms: | CXCL12 | Chemokine CXCL12 | SDF1 | SDF1A | SDF1B | SDF1_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10677.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P48061 |
|---|
| Residue: | 93 |
|---|
| Sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
|
|
|
|---|
| BDBM50369279 |
|---|
| n/a |
|---|
| Name | BDBM50369279 |
|---|
| Synonyms: | CHEMBL4166454 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H13ClN2O3 |
|---|
| Mol. Mass. | 328.75 |
|---|
| SMILES | COc1cc(ccc1O)-c1cc(nc(=O)[nH]1)-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
