| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 17-beta-hydroxysteroid dehydrogenase type 1 |
|---|
| Ligand | BDBM50042944 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1744044 (CHEMBL4178554) |
|---|
| IC50 | 2830±n/a nM |
|---|
| Citation |  Vuorinen, A; Engeli, RT; Leugger, S; Bachmann, F; Akram, M; Atanasov, AG; Waltenberger, B; Temml, V; Stuppner, H; Krenn, L; Ateba, SB; Njamen, D; Davis, RA; Odermatt, A; Schuster, D Potential Antiosteoporotic Natural Product Lead Compounds That Inhibit 17?-Hydroxysteroid Dehydrogenase Type 2. J Nat Prod80:965-974 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 17-beta-hydroxysteroid dehydrogenase type 1 |
|---|
| Name: | 17-beta-hydroxysteroid dehydrogenase type 1 |
|---|
| Synonyms: | 17-beta-HSD 1 | 17-beta-Hydroxysteroid Dehydrogenase 1 (17-beta-HSD1) | 17-beta-hydroxysteroid dehydrogenase type 1 | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | DHB1_HUMAN | E17KSR | E2DH | EDH17B1 | EDH17B2 | EDHB17 | Estradiol 17-beta-dehydrogenase 1 | Estradiol 17-beta-dehydrogenase 1 (17beta-HSD1) | HSD17B1 | Placental 17-beta-hydroxysteroid dehydrogenase | SDR28C1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34945.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14061 |
|---|
| Residue: | 328 |
|---|
| Sequence: | MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
|
|
|
|---|
| BDBM50042944 |
|---|
| n/a |
|---|
| Name | BDBM50042944 |
|---|
| Synonyms: | (E)-1-(2,4-Dihydroxy-phenyl)-3-(4-hydroxy-phenyl)-propenone | (E)-1-(2,4-dihydroxyphenyl)-3-(4-hydroxyphenyl)prop-2-en-1-one | 1-(2,4-Dihydroxy-phenyl)-3-(4-hydroxy-phenyl)-propenone | 1-(2,4-Dihydroxyphenyl)-3-(4-hydroxyphenyl)-prop-2-en-1-one | 1-(2,4-dihydroxyphenyl)-3-(4-hydroxyphenyl)prop-2-en-1-one | 2',4',4-trihydroxychalcone | 2',4,4'-trihydroxychalcone | 2,4'-dihydroxy-4-hydroxychalcone | CHEMBL129795 | Isoliquiritigenin (1) | cid_638278 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12O4 |
|---|
| Mol. Mass. | 256.2534 |
|---|
| SMILES | Oc1ccc(\C=C\C(=O)c2ccc(O)cc2O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
