Reaction Details |
| Report a problem with these data |
Target | Retinoic acid receptor alpha |
---|
Ligand | BDBM31883 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1752309 (CHEMBL4187069) |
---|
EC50 | 1.0±n/a nM |
---|
Citation | Clarke, E; Jarvis, CI; Goncalves, MB; Kalindjian, SB; Adams, DR; Brown, JT; Shiers, JJ; Taddei, DMA; Ravier, E; Barlow, S; Miller, I; Smith, V; Borthwick, AD; Corcoran, JPT Design and synthesis of a potent, highly selective, orally bioavailable, retinoic acid receptor alpha agonist. Bioorg Med Chem26:798-814 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinoic acid receptor alpha |
---|
Name: | Retinoic acid receptor alpha |
Synonyms: | NR1B1 | Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | RARA | RARA_HUMAN | Retinoic acid receptor alpha | Retinoic acid receptor alpha/Retinoid X receptor alpha | Retinoid X receptor gamma/retinoic acid receptor alpha | Retinoid receptor |
Type: | PROTEIN |
Mol. Mass.: | 50778.87 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1466191 |
Residue: | 462 |
Sequence: | MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
|
|
|
BDBM31883 |
---|
n/a |
---|
Name | BDBM31883 |
Synonyms: | 9-cis-retinoic acid (9cRA) | ALL-TRANS-RETINOIC ACID | AT-RA | Atralin | CHEMBL38 | MLS000028588 | SMR000058245 | TRETINOIN | Vitamin A acid | [3H]RA | [3H]Retinoic acid | [3H]Vitamin A acid | [3H]tretinoin | all-trans retinoic acid | cid_444795 |
Type | radiolabeled ligand |
Emp. Form. | C20H28O2 |
Mol. Mass. | 300.4351 |
SMILES | C\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(O)=O |c:4| |
Structure |
|