| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50456166 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1755206 (CHEMBL4189966) |
|---|
| Ki | 1200±n/a nM |
|---|
| Citation |  Yu, J; Ciancetta, A; Dudas, S; Duca, S; Lottermoser, J; Jacobson, KA Structure-Guided Modification of Heterocyclic Antagonists of the P2Y J Med Chem61:4860-4882 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20857.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q5BJF2 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
|---|
| BDBM50456166 |
|---|
| n/a |
|---|
| Name | BDBM50456166 |
|---|
| Synonyms: | CHEMBL4216870 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H46F3N5O2 |
|---|
| Mol. Mass. | 697.8314 |
|---|
| SMILES | NCCCCCCn1cc(CCCCN2CCC(CC2)c2ccc(cc2)-c2cc(cc3cc(ccc23)-c2ccc(cc2)C(F)(F)F)C(O)=O)nn1 |
|---|
| Structure | 
|
|---|
Search and Browse
