| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2, membrane associated |
|---|
| Ligand | BDBM50458617 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1764263 (CHEMBL4199510) |
|---|
| IC50 | 630±n/a nM |
|---|
| Citation |  Giordanetto, F; Knerr, L; Nordberg, P; Pettersen, D; Selmi, N; Beisel, HG; de la Motte, H; Månsson, Å; Dahlström, M; Broddefalk, J; Saarinen, G; Klingegård, F; Hurt-Camejo, E; Rosengren, B; Wikström, J; Wågberg, M; Brengdahl, J; Rohman, M; Sandmark, J; Åkerud, T; Roth, RG; Jansen, F; Ahlqvist, M Design of Selective sPLA ACS Med Chem Lett9:600-605 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2, membrane associated |
|---|
| Name: | Phospholipase A2, membrane associated |
|---|
| Synonyms: | GIIC sPLA2 | Group IIA phospholipase A2 | NPS-PLA2 | Non-Pancreatic Secretory Phospholipase A2 | Non-pancreatic secretory phospholipase A2 (hnps-PLA2) | PA2GA_HUMAN | PLA2B | PLA2G2A | PLA2L | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 group IIA | RASF-A |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 16101.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The human nps PLA2 was cloned, and expressed in E. coli. There was a refolding process in the purification. |
|---|
| Residue: | 144 |
|---|
| Sequence: | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
|
|
|
|---|
| BDBM50458617 |
|---|
| n/a |
|---|
| Name | BDBM50458617 |
|---|
| Synonyms: | CHEMBL4215835 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16F3N3O4 |
|---|
| Mol. Mass. | 407.3432 |
|---|
| SMILES | CC(CC(O)=O)c1cccc(n1)-n1c(cc2ccc(OC(F)(F)F)cc12)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
