| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM50462351 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1774622 (CHEMBL4231614) |
|---|
| IC50 | 130±n/a nM |
|---|
| Citation |  Gür, ZT; Çal??kan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E Identification of multi-target inhibitors of leukotriene and prostaglandin E Eur J Med Chem150:876-899 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM50462351 |
|---|
| n/a |
|---|
| Name | BDBM50462351 |
|---|
| Synonyms: | CHEMBL4241055 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H28ClN3O |
|---|
| Mol. Mass. | 445.984 |
|---|
| SMILES | CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
