| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator EthR |
|---|
| Ligand | BDBM50462583 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1775693 (CHEMBL4232685) |
|---|
| IC50 | 580±n/a nM |
|---|
| Citation |  Unver, MY; Gierse, RM; Ritchie, H; Hirsch, AKH Druggability Assessment of Targets Used in Kinetic Target-Guided Synthesis. J Med Chem61:9395-9409 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator EthR |
|---|
| Name: | HTH-type transcriptional regulator EthR |
|---|
| Synonyms: | ETHR_MYCTU | HTH-type transcriptional regulator EthR | Transcriptional repressor EthR (EthR) | etaR | ethR |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.94 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | P9WMC1 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT
FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAV
TRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNE
RTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
|
|
|
|---|
| BDBM50462583 |
|---|
| n/a |
|---|
| Name | BDBM50462583 |
|---|
| Synonyms: | CHEMBL1234901 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22IN7O4S2 |
|---|
| Mol. Mass. | 639.489 |
|---|
| SMILES | Ic1ccc(cc1)S(=O)(=O)NCc1cn(CC(=O)N2CCC(CC2)c2nc(no2)-c2cccs2)nn1 |
|---|
| Structure | 
|
|---|
Search and Browse
