Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50405398 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54892 |
---|
IC50 | 120±n/a nM |
---|
Citation | DeGraw, JI; Christie, PH; Tagawa, H; Kisliuk, RL; Gaumont, Y; Schmid, FA; Sirotnak, FM Synthesis and biological activity of resolved C-10 diastereomers of 10-methyl- and 10-ethyl-10-deazaminopterin. J Med Chem29:1056-61 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50405398 |
---|
n/a |
---|
Name | BDBM50405398 |
Synonyms: | CHEMBL2051991 |
Type | Small organic molecule |
Emp. Form. | C22H27N7O5 |
Mol. Mass. | 469.4937 |
SMILES | CC[C@@H](CC1=Nc2c(N)nc(N)nc2NC1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r,t:4| |
Structure |
|