| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50059966 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_211334 (CHEMBL820777) |
|---|
| IC50 | 660±n/a nM |
|---|
| Citation |  Chen, K; Kuo, SC; Hsieh, MC; Mauger, A; Lin, CM; Hamel, E; Lee, KH Antitumor agents. 178. Synthesis and biological evaluation of substituted 2-aryl-1,8-naphthyridin-4(1H)-ones as antitumor agents that inhibit tubulin polymerization. J Med Chem40:3049-56 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50059966 |
|---|
| n/a |
|---|
| Name | BDBM50059966 |
|---|
| Synonyms: | 7-Methyl-2-naphthalen-1-yl-1H-[1,8]naphthyridin-4-one | CHEMBL52342 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H14N2O |
|---|
| Mol. Mass. | 286.3273 |
|---|
| SMILES | Cc1ccc2c(O)cc(nc2n1)-c1cccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
