| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50480766 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_583932 (CHEMBL1061783) |
|---|
| Kd | 2990±n/a nM |
|---|
| Citation |  Zelina, S; Sheen, CW; Radzio, J; Mellors, JW; Sluis-Cremer, N Mechanisms by which the G333D mutation in human immunodeficiency virus type 1 Reverse transcriptase facilitates dual resistance to zidovudine and lamivudine. Antimicrob Agents Chemother52:157-63 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50480766 |
|---|
| n/a |
|---|
| Name | BDBM50480766 |
|---|
| Synonyms: | 2''-Deoxycytidine 5''-Triphosphate | CHEBI:16311 | Deoxycytidine Triphosphate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H16N3O13P3 |
|---|
| Mol. Mass. | 467.1569 |
|---|
| SMILES | Nc1ccn([C@H]2C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O2)c(=O)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
