Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50480936 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_594343 (CHEMBL1048541) |
---|
Ki | 1.8±n/a nM |
---|
Citation | Mahalingam, AK; Axelsson, L; Ekegren, JK; Wannberg, J; Kihlström, J; Unge, T; Wallberg, H; Samuelsson, B; Larhed, M; Hallberg, A HIV-1 protease inhibitors with a transition-state mimic comprising a tertiary alcohol: improved antiviral activity in cells. J Med Chem53:607-15 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50480936 |
---|
n/a |
---|
Name | BDBM50480936 |
Synonyms: | CHEMBL574733 |
Type | Small organic molecule |
Emp. Form. | C43H51N5O7 |
Mol. Mass. | 749.8943 |
SMILES | COC(=O)N[C@H](C(=O)NN(CC[C@@](O)(Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)Cc1ccc(cc1)-c1ccc(NC(C)=O)cc1)C(C)(C)C |r| |
Structure |
|