| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50480946 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_594343 (CHEMBL1048541) |
|---|
| Ki | 1.1±n/a nM |
|---|
| Citation |  Mahalingam, AK; Axelsson, L; Ekegren, JK; Wannberg, J; Kihlström, J; Unge, T; Wallberg, H; Samuelsson, B; Larhed, M; Hallberg, A HIV-1 protease inhibitors with a transition-state mimic comprising a tertiary alcohol: improved antiviral activity in cells. J Med Chem53:607-15 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50480946 |
|---|
| n/a |
|---|
| Name | BDBM50480946 |
|---|
| Synonyms: | CHEMBL583568 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H48N6O6 |
|---|
| Mol. Mass. | 612.7601 |
|---|
| SMILES | CNC(=O)[C@@H](NC(=O)[C@@](O)(CCN(Cc1ccccn1)NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)Cc1ccccc1)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
