| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50481585 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_610130 (CHEMBL1074495) |
|---|
| Ki | 86±n/a nM |
|---|
| Citation |  Ghosh, AK; Gemma, S; Simoni, E; Baldridge, A; Walters, DE; Ide, K; Tojo, Y; Koh, Y; Amano, M; Mitsuya, H Synthesis and biological evaluation of novel allophenylnorstatine-based HIV-1 protease inhibitors incorporating high affinity P2-ligands. Bioorg Med Chem Lett20:1241-6 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50481585 |
|---|
| n/a |
|---|
| Name | BDBM50481585 |
|---|
| Synonyms: | CHEMBL603666 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H39N3O5S |
|---|
| Mol. Mass. | 541.702 |
|---|
| SMILES | Cc1ccccc1CNC(=O)[C@H]1N(C[C@@H](O)[C@H](Cc2ccccc2)NC(=O)O[C@H]2CCOC2)CSC1(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
