Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Retinol-binding protein 4 |
---|
Ligand | BDBM50501920 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1805921 (CHEMBL4305280) |
---|
IC50 | 9.7±n/a nM |
---|
Citation | Cioffi, CL; Racz, B; Varadi, A; Freeman, EE; Conlon, MP; Chen, P; Zhu, L; Kitchen, DB; Barnes, KD; Martin, WH; Pearson, PG; Johnson, G; Blaner, WS; Petrukhin, K Design, Synthesis, and Preclinical Efficacy of Novel Nonretinoid Antagonists of Retinol-Binding Protein 4 in the Mouse Model of Hepatic Steatosis. J Med Chem62:5470-5500 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinol-binding protein 4 |
---|
Name: | Retinol-binding protein 4 |
Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
Type: | Protein |
Mol. Mass.: | 23008.75 |
Organism: | Homo sapiens (Human) |
Description: | P02753 |
Residue: | 201 |
Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
BDBM50501920 |
---|
n/a |
---|
Name | BDBM50501920 |
Synonyms: | CHEMBL4452180 |
Type | Small organic molecule |
Emp. Form. | C20H18F3N3O |
Mol. Mass. | 373.3716 |
SMILES | FC(F)(F)c1ccccc1C1CCN(CC1)C(=O)c1cn2ccccc2n1 |
Structure |
|