| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM249562 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1805921 (CHEMBL4305280) |
|---|
| IC50 | 9.1±n/a nM |
|---|
| Citation |  Cioffi, CL; Racz, B; Varadi, A; Freeman, EE; Conlon, MP; Chen, P; Zhu, L; Kitchen, DB; Barnes, KD; Martin, WH; Pearson, PG; Johnson, G; Blaner, WS; Petrukhin, K Design, Synthesis, and Preclinical Efficacy of Novel Nonretinoid Antagonists of Retinol-Binding Protein 4 in the Mouse Model of Hepatic Steatosis. J Med Chem62:5470-5500 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM249562 |
|---|
| n/a |
|---|
| Name | BDBM249562 |
|---|
| Synonyms: | US10072016, Compound 160 | US10407433, Compound 160 | US10913746, Compound 160 | US11649240, Compound 160 | US9434727, 160 | US9777010, Compound 160 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H15F4N5O |
|---|
| Mol. Mass. | 417.3596 |
|---|
| SMILES | Fc1ccc(C2CCN(CC2)C(=O)c2nnc3ccc(cn23)C#N)c(c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
