Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50483340 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_715372 (CHEMBL1664701) |
---|
Ki | 9.0±n/a nM |
---|
Citation | Ghosh, AK; Chapsal, BD; Baldridge, A; Steffey, MP; Walters, DE; Koh, Y; Amano, M; Mitsuya, H Design and synthesis of potent HIV-1 protease inhibitors incorporating hexahydrofuropyranol-derived high affinity P(2) ligands: structure-activity studies and biological evaluation. J Med Chem54:622-34 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50483340 |
---|
n/a |
---|
Name | BDBM50483340 |
Synonyms: | CHEMBL1651157 |
Type | Small organic molecule |
Emp. Form. | C31H44N2O6S |
Mol. Mass. | 572.756 |
SMILES | [H][C@]12CCC[C@@]1([H])[C@H](CCC2)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
Structure |
|