| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50484004 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_755992 (CHEMBL1803968) |
|---|
| IC50 | 510±n/a nM |
|---|
| Citation |  Chung, S; Himmel, DM; Jiang, JK; Wojtak, K; Bauman, JD; Rausch, JW; Wilson, JA; Beutler, JA; Thomas, CJ; Arnold, E; Le Grice, SF Synthesis, activity, and structural analysis of novel ?-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H. J Med Chem54:4462-73 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50484004 |
|---|
| n/a |
|---|
| Name | BDBM50484004 |
|---|
| Synonyms: | CHEMBL1802251 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24O6S |
|---|
| Mol. Mass. | 404.477 |
|---|
| SMILES | [H][C@@]1(CCc2c(C1)c(C)cc(O)c(=O)c2O)C(C)(O)CS(=O)(=O)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
