| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsin-like protease CTRL-1 |
|---|
| Ligand | BDBM50484482 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_794323 (CHEMBL1932245) |
|---|
| IC50 | 5700±n/a nM |
|---|
| Citation |  Akaji, K; Konno, H; Mitsui, H; Teruya, K; Shimamoto, Y; Hattori, Y; Ozaki, T; Kusunoki, M; Sanjoh, A Structure-based design, synthesis, and evaluation of peptide-mimetic SARS 3CL protease inhibitors. J Med Chem54:7962-73 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsin-like protease CTRL-1 |
|---|
| Name: | Chymotrypsin-like protease CTRL-1 |
|---|
| Synonyms: | CTRL | CTRL1 | CTRL_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28008.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_49606 |
|---|
| Residue: | 264 |
|---|
| Sequence: | MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFC
GGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNN
DVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALP
LVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCN
VRAPAVYTRVSKFSTWINQVIAYN
|
|
|
|---|
| BDBM50484482 |
|---|
| n/a |
|---|
| Name | BDBM50484482 |
|---|
| Synonyms: | CHEMBL1929017 | acs.jmedchem.1c00409_ST.380 | med.21724, Compound 45 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H41N7O7 |
|---|
| Mol. Mass. | 551.6357 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(C)=O)C(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
