| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50485122 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_818090 (CHEMBL2033732) |
|---|
| Ki | 1.7±n/a nM |
|---|
| Citation |  Wu, X; Ohrngren, P; Joshi, AA; Trejos, A; Persson, M; Arvela, RK; Wallberg, H; Vrang, L; Rosenquist, A; Samuelsson, BB; Unge, J; Larhed, M Synthesis, X-ray analysis, and biological evaluation of a new class of stereopure lactam-based HIV-1 protease inhibitors. J Med Chem55:2724-36 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50485122 |
|---|
| n/a |
|---|
| Name | BDBM50485122 |
|---|
| Synonyms: | CHEMBL2030955 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H49N5O6 |
|---|
| Mol. Mass. | 719.8684 |
|---|
| SMILES | COC(=O)N[C@H](C(=O)NN(CC[C@]1(Cc2ccccc2)[C@@H](O)CN([C@@H]2[C@H](O)Cc3ccccc23)C1=O)Cc1ccc(cc1)-c1ccncc1)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
