| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM34860 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_940682 (CHEMBL2327748) |
|---|
| IC50 | >20000±n/a nM |
|---|
| Citation |  Serrao, E; Debnath, B; Otake, H; Kuang, Y; Christ, F; Debyser, Z; Neamati, N Fragment-based discovery of 8-hydroxyquinoline inhibitors of the HIV-1 integrase-lens epithelium-derived growth factor/p75 (IN-LEDGF/p75) interaction. J Med Chem56:2311-22 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM34860 |
|---|
| n/a |
|---|
| Name | BDBM34860 |
|---|
| Synonyms: | 4-[(8-hydroxy-5-quinolinyl)methyl]-1-piperazinecarboxylic acid ethyl ester | 4-[(8-hydroxy-5-quinolyl)methyl]piperazine-1-carboxylic acid ethyl ester | MLS000715648 | SMR000277165 | cid_1090305 | ethyl 4-[(8-hydroxyquinolin-5-yl)methyl]piperazine-1-carboxylate | ethyl 4-[(8-oxidanylquinolin-5-yl)methyl]piperazine-1-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H21N3O3 |
|---|
| Mol. Mass. | 315.3669 |
|---|
| SMILES | CCOC(=O)N1CCN(Cc2ccc(O)c3ncccc23)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
