| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50492106 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_969007 (CHEMBL2400596) |
|---|
| IC50 | 590±n/a nM |
|---|
| Citation |  Masaoka, T; Chung, S; Caboni, P; Rausch, JW; Wilson, JA; Taskent-Sezgin, H; Beutler, JA; Tocco, G; Le Grice, SF Exploiting drug-resistant enzymes as tools to identify thienopyrimidinone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H. J Med Chem56:5436-45 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50492106 |
|---|
| n/a |
|---|
| Name | BDBM50492106 |
|---|
| Synonyms: | CHEMBL2397401 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H18N2O3S |
|---|
| Mol. Mass. | 330.401 |
|---|
| SMILES | CCCc1c(CC)sc2nc([nH]c(=O)c12)-c1ccc(O)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
