Reaction Details |
| Report a problem with these data |
Target | 3',5'-cyclic-AMP phosphodiesterase |
---|
Ligand | BDBM50038982 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_155848 (CHEMBL766944) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Takase, Y; Saeki, T; Watanabe, N; Adachi, H; Souda, S; Saito, I Cyclic GMP phosphodiesterase inhibitors. 2. Requirement of 6-substitution of quinazoline derivatives for potent and selective inhibitory activity. J Med Chem37:2106-11 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3',5'-cyclic-AMP phosphodiesterase |
---|
Name: | 3',5'-cyclic-AMP phosphodiesterase |
Synonyms: | Phosphodiesterase 4A |
Type: | PROTEIN |
Mol. Mass.: | 13615.65 |
Organism: | Sus scrofa |
Description: | ChEMBL_155848 |
Residue: | 118 |
Sequence: | PWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVDIPSPTMKDHEKQQ
APRQRPSQQPPPPGPQFQPMSQITGVKKLMHSSSLNEDSSIPRFGVKTDQEELLAQEL
|
|
|
BDBM50038982 |
---|
n/a |
---|
Name | BDBM50038982 |
Synonyms: | Benzo[1,3]dioxol-5-ylmethyl-(6-methoxy-quinazolin-4-yl)-amine | CHEMBL66323 |
Type | Small organic molecule |
Emp. Form. | C17H15N3O3 |
Mol. Mass. | 309.3193 |
SMILES | COc1ccc2ncnc(NCc3ccc4OCOc4c3)c2c1 |
Structure |
|