Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50346701 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1298586 (CHEMBL3132373) |
---|
IC50 | 31200±n/a nM |
---|
Citation | Parra, A; Martin-Fonseca, S; Rivas, F; Reyes-Zurita, FJ; Medina-O'Donnell, M; Martinez, A; Garcia-Granados, A; Lupiaņez, JA; Albericio, F Semi-synthesis of acylated triterpenes from olive-oil industry wastes for the development of anticancer and anti-HIV agents. Eur J Med Chem74:278-301 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50346701 |
---|
n/a |
---|
Name | BDBM50346701 |
Synonyms: | CHEMBL1797017 |
Type | Small organic molecule |
Emp. Form. | C38H60O6 |
Mol. Mass. | 612.8794 |
SMILES | CCCC(=O)O[C@@H]1C[C@@]2(C)[C@@H](CC[C@]3(C)[C@@H]2CC=C2[C@@H]4CC(C)(C)CC[C@@]4(CC[C@@]32C)C(O)=O)C(C)(C)[C@H]1OC(=O)CCC |r,t:18| |
Structure |
|