| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50346701 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1298586 (CHEMBL3132373) |
|---|
| IC50 | 31200±n/a nM |
|---|
| Citation |  Parra, A; Martin-Fonseca, S; Rivas, F; Reyes-Zurita, FJ; Medina-O'Donnell, M; Martinez, A; Garcia-Granados, A; Lupiaņez, JA; Albericio, F Semi-synthesis of acylated triterpenes from olive-oil industry wastes for the development of anticancer and anti-HIV agents. Eur J Med Chem74:278-301 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50346701 |
|---|
| n/a |
|---|
| Name | BDBM50346701 |
|---|
| Synonyms: | CHEMBL1797017 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H60O6 |
|---|
| Mol. Mass. | 612.8794 |
|---|
| SMILES | CCCC(=O)O[C@@H]1C[C@@]2(C)[C@@H](CC[C@]3(C)[C@@H]2CC=C2[C@@H]4CC(C)(C)CC[C@@]4(CC[C@@]32C)C(O)=O)C(C)(C)[C@H]1OC(=O)CCC |r,t:18| |
|---|
| Structure | 
|
|---|
Search and Browse
