| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chromobox protein homolog 7 |
|---|
| Ligand | BDBM50341828 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1300216 (CHEMBL3136680) |
|---|
| IC50 | >30000±n/a nM |
|---|
| Citation |  Camerino, MA; Zhong, N; Dong, A; Dickson, BM; James, LI; Baughman, BM; Norris, JL; Kireev, DB; Janzen, WP; Arrowsmith, CH; Frye, SV The structure-activity relationships of L3MBTL3 inhibitors: flexibility of the dimer interface. Medchemcomm4:1501-1507 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chromobox protein homolog 7 |
|---|
| Name: | Chromobox protein homolog 7 |
|---|
| Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28351.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 251 |
|---|
| Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
|---|
| BDBM50341828 |
|---|
| n/a |
|---|
| Name | BDBM50341828 |
|---|
| Synonyms: | 3-bromo-5-[(4-pyrrolidin-1-ylpiperidin-1-yl)carbonyl]pyridine | 5-Bromo-N-(4-(pyrrolidinyl)piperidinyl)nicotinamide | CHEMBL1235119 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H20BrN3O |
|---|
| Mol. Mass. | 338.243 |
|---|
| SMILES | Brc1cncc(c1)C(=O)N1CCC(CC1)N1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
