Reaction Details |
| Report a problem with these data |
Target | Chromobox protein homolog 7 |
---|
Ligand | BDBM50496589 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1300216 (CHEMBL3136680) |
---|
IC50 | >30000±n/a nM |
---|
Citation | Camerino, MA; Zhong, N; Dong, A; Dickson, BM; James, LI; Baughman, BM; Norris, JL; Kireev, DB; Janzen, WP; Arrowsmith, CH; Frye, SV The structure-activity relationships of L3MBTL3 inhibitors: flexibility of the dimer interface. Medchemcomm4:1501-1507 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chromobox protein homolog 7 |
---|
Name: | Chromobox protein homolog 7 |
Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
Type: | Protein |
Mol. Mass.: | 28351.76 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 251 |
Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
BDBM50496589 |
---|
n/a |
---|
Name | BDBM50496589 |
Synonyms: | CHEMBL3134126 |
Type | Small organic molecule |
Emp. Form. | C22H35N3 |
Mol. Mass. | 341.5334 |
SMILES | C(Cc1ccc(cc1)N1CCC(CC1)N1CCCC1)N1CCCCC1 |
Structure |
|