| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50046423 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159311 (CHEMBL769364) |
|---|
| IC50 | 240±n/a nM |
|---|
| Citation |  Kempf, DJ; Codacovi, L; Wang, XC; Kohlbrenner, WE; Wideburg, NE; Saldivar, A; Vasavanonda, S; Marsh, KC; Bryant, P; Sham, HL Symmetry-based inhibitors of HIV protease. Structure-activity studies of acylated 2,4-diamino-1,5-diphenyl-3-hydroxypentane and 2,5-diamino-1,6-diphenylhexane-3,4-diol. J Med Chem36:320-30 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50046423 |
|---|
| n/a |
|---|
| Name | BDBM50046423 |
|---|
| Synonyms: | 1N-[1-benzyl-2,3-dihydroxy-4-[2-methyl-1-methyl(2-pyridylmethyl)aminosulfomoyl-(1R)-propylcarboxamido]-5-phenyl-(1S,2R,3S,4S)-pentyl]-3-methyl-2-methyl(2-pyridylmethyl)aminosulfomoyl-(2S)-butanamide | CHEMBL320243 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H58N8O8S2 |
|---|
| Mol. Mass. | 867.089 |
|---|
| SMILES | CC(C)[C@H](NS(=O)(=O)N(C)Cc1ccccn1)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](NS(=O)(=O)N(C)Cc1ccccn1)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
