Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50046387 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159311 (CHEMBL769364) |
---|
IC50 | 9±n/a nM |
---|
Citation | Kempf, DJ; Codacovi, L; Wang, XC; Kohlbrenner, WE; Wideburg, NE; Saldivar, A; Vasavanonda, S; Marsh, KC; Bryant, P; Sham, HL Symmetry-based inhibitors of HIV protease. Structure-activity studies of acylated 2,4-diamino-1,5-diphenyl-3-hydroxypentane and 2,5-diamino-1,6-diphenylhexane-3,4-diol. J Med Chem36:320-30 (1993) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50046387 |
---|
n/a |
---|
Name | BDBM50046387 |
Synonyms: | (1-{1-Benzyl-2-hydroxy-3-[3-methyl-2-(2-morpholin-4-yl-ethoxycarbonylamino)-butyrylamino]-4-phenyl-butylcarbamoyl}-2-methyl-propyl)-carbamic acid benzyl ester | CHEMBL112412 |
Type | Small organic molecule |
Emp. Form. | C42H57N5O8 |
Mol. Mass. | 759.9307 |
SMILES | CC(C)[C@H](NC(=O)OCCN1CCOCC1)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](NC(=O)OCc1ccccc1)C(C)C |
Structure |
|