Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50498527 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1511389 (CHEMBL3606514) |
---|
Ki | 0.014000±n/a nM |
---|
Citation | Ghosh, AK; Martyr, CD; Osswald, HL; Sheri, VR; Kassekert, LA; Chen, S; Agniswamy, J; Wang, YF; Hayashi, H; Aoki, M; Weber, IT; Mitsuya, H Design of HIV-1 Protease Inhibitors with Amino-bis-tetrahydrofuran Derivatives as P2-Ligands to Enhance Backbone-Binding Interactions: Synthesis, Biological Evaluation, and Protein-Ligand X-ray Studies. J Med Chem58:6994-7006 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50498527 |
---|
n/a |
---|
Name | BDBM50498527 |
Synonyms: | CHEMBL3605640 |
Type | Small organic molecule |
Emp. Form. | C33H47N3O10S |
Mol. Mass. | 677.805 |
SMILES | [H][C@]12OC[C@H](NC(=O)OC(C)(C)C)[C@@]1([H])[C@H](CO2)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
Structure |
|