| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50498846 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1522895 (CHEMBL3630768) |
|---|
| Ki | >200000±n/a nM |
|---|
| Citation |  Chauhan, J; Chen, SE; Fenstermacher, KJ; Naser-Tavakolian, A; Reingewertz, T; Salmo, R; Lee, C; Williams, E; Raje, M; Sundberg, E; DeStefano, JJ; Freire, E; Fletcher, S Synthetic, structural mimetics of the ?-hairpin flap of HIV-1 protease inhibit enzyme function. Bioorg Med Chem23:7095-109 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50498846 |
|---|
| n/a |
|---|
| Name | BDBM50498846 |
|---|
| Synonyms: | CHEMBL3629721 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H46N4O6 |
|---|
| Mol. Mass. | 678.8164 |
|---|
| SMILES | CC(C)C[C@H]1N=C(C)c2ccc(cc2N(CC(=O)N2CCN(CC2)C(=O)OCC2c3ccccc3-c3ccccc23)C1=O)C(=O)OC(C)(C)C |r,t:5| |
|---|
| Structure | 
|
|---|
Search and Browse
