Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50498861 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1522895 (CHEMBL3630768) |
---|
Ki | 88000±n/a nM |
---|
Citation | Chauhan, J; Chen, SE; Fenstermacher, KJ; Naser-Tavakolian, A; Reingewertz, T; Salmo, R; Lee, C; Williams, E; Raje, M; Sundberg, E; DeStefano, JJ; Freire, E; Fletcher, S Synthetic, structural mimetics of the ?-hairpin flap of HIV-1 protease inhibit enzyme function. Bioorg Med Chem23:7095-109 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50498861 |
---|
n/a |
---|
Name | BDBM50498861 |
Synonyms: | CHEMBL3629378 |
Type | Small organic molecule |
Emp. Form. | C29H36N2O3 |
Mol. Mass. | 460.6077 |
SMILES | C[C@@H]1N=C(C)c2ccc(cc2N(Cc2ccc(cc2)C2CCCCC2)C1=O)C(=O)OC(C)(C)C |r,t:2| |
Structure |
|