Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50049579 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52843 (CHEMBL665047) |
---|
IC50 | 150±n/a nM |
---|
Citation | Gangjee, A; Zhu, Y; Queener, SF; Francom, P; Broom, AD Nonclassical 2,4-diamino-8-deazafolate analogues as inhibitors of dihydrofolate reductases from rat liver, Pneumocystis carinii, and Toxoplasma gondii. J Med Chem39:1836-45 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DFR1 | DYR_YEAST |
Type: | PROTEIN |
Mol. Mass.: | 24263.24 |
Organism: | Saccharomyces cerevisiae |
Description: | ChEMBL_52843 |
Residue: | 211 |
Sequence: | MAGGKIPIVGIVACLQPEMGIGFRGGLPWRLPSEMKYFRQVTSLTKDPNKKNALIMGRKT
WESIPPKFRPLPNRMNVIISRSFKDDFVHDKERSIVQSNSLANAIMNLESNFKEHLERIY
VIGGGEVYSQIFSITDHWLITKINPLDKNATPAMDTFLDAKKLEEVFSEQDPAQLKEFLP
PKVELPETDCDQRYSLEEKGYCFEFTLYNRK
|
|
|
BDBM50049579 |
---|
n/a |
---|
Name | BDBM50049579 |
Synonyms: | 6-{[(2,5-Dichloro-phenyl)-methyl-amino]-methyl}-pyrido[3,2-d]pyrimidine-2,4-diamine | CHEMBL55191 |
Type | Small organic molecule |
Emp. Form. | C15H14Cl2N6 |
Mol. Mass. | 349.218 |
SMILES | CN(Cc1ccc2nc(N)nc(N)c2n1)c1cc(Cl)ccc1Cl |
Structure |
|