| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Ligand | BDBM50500613 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1548485 (CHEMBL3756832) |
|---|
| Kd | 2.1±n/a nM |
|---|
| Citation |  Yang, S; K R, J; Lim, S; Choi, TG; Kim, JH; Akter, S; Jang, M; Ahn, HJ; Kim, HY; Windisch, MP; Khadka, DB; Zhao, C; Jin, Y; Kang, I; Ha, J; Oh, BC; Kim, M; Kim, SS; Cho, WJ Structure-Based Discovery of Novel Cyclophilin A Inhibitors for the Treatment of Hepatitis C Virus Infections. J Med Chem58:9546-61 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase B |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P23284 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
|---|
| BDBM50500613 |
|---|
| n/a |
|---|
| Name | BDBM50500613 |
|---|
| Synonyms: | CHEMBL3752642 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H43N3O5 |
|---|
| Mol. Mass. | 597.7437 |
|---|
| SMILES | COc1cc(cc(OC)c1OC)C(N(C(=O)Cc1c[nH]c2ccccc12)c1ccc(cc1)C(C)C)C(=O)NC1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
