| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Monoglyceride lipase |
|---|
| Ligand | BDBM180052 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1810393 (CHEMBL4309853) |
|---|
| IC50 | 27±n/a nM |
|---|
| Citation |  Cisar, JS; Weber, OD; Clapper, JR; Blankman, JL; Henry, CL; Simon, GM; Alexander, JP; Jones, TK; Ezekowitz, RAB; O'Neill, GP; Grice, CA Identification of ABX-1431, a Selective Inhibitor of Monoacylglycerol Lipase and Clinical Candidate for Treatment of Neurological Disorders. J Med Chem61:9062-9084 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Monoglyceride lipase |
|---|
| Name: | Monoglyceride lipase |
|---|
| Synonyms: | MAG lipase | MGLL_MOUSE | Mgll | Monoacylglycerol lipase | Monoglyceride Lipase (MGL) |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 33391.67 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells. |
|---|
| Residue: | 303 |
|---|
| Sequence: | MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
|
|
|
|---|
| BDBM180052 |
|---|
| n/a |
|---|
| Name | BDBM180052 |
|---|
| Synonyms: | US9133148, 9aq |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22F9N3O2 |
|---|
| Mol. Mass. | 507.3932 |
|---|
| SMILES | FC(F)(F)C(OC(=O)N1CCN(Cc2ccc(cc2N2CCCC2)C(F)(F)F)CC1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
