Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50064201 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158768 (CHEMBL772929) |
---|
Ki | 0.16±n/a nM |
---|
Citation | Martin, SF; Dorsey, GO; Gane, T; Hillier, MC; Kessler, H; Baur, M; Mathä, B; Erickson, JW; Bhat, TN; Munshi, S; Gulnik, SV; Topol, IA Cyclopropane-derived peptidomimetics. Design, synthesis, evaluation, and structure of novel HIV-1 protease inhibitors. J Med Chem41:1581-97 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50064201 |
---|
n/a |
---|
Name | BDBM50064201 |
Synonyms: | 1N-benzyl-2N-[1-benzyl-4-(2-benzylcarbamoyl-3-methylcyclopropylcarboxamido)-2,3-dihydroxy-5-phenylpentyl]-3-methyl-1,2-cyclopropanedicarboxamide | CHEMBL433446 |
Type | Small organic molecule |
Emp. Form. | C44H50N4O6 |
Mol. Mass. | 730.891 |
SMILES | C[C@H]1[C@H]([C@@H]1C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1[C@@H](C)[C@H]1C(=O)NCc1ccccc1)C(=O)NCc1ccccc1 |
Structure |
|