| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50510468 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1841510 (CHEMBL4341809) |
|---|
| IC50 | 570±n/a nM |
|---|
| Citation |  Zhu, M; Dong, B; Zhang, GN; Wang, JX; Cen, S; Wang, YC Synthesis and biological evaluation of new HIV-1 protease inhibitors with purine bases as P2-ligands. Bioorg Med Chem Lett29:1541-1545 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50510468 |
|---|
| n/a |
|---|
| Name | BDBM50510468 |
|---|
| Synonyms: | CHEMBL4593844 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H34ClN7O5S |
|---|
| Mol. Mass. | 616.131 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)N(CC(C)C)C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)Cn1cnc2c(Cl)nc(N)nc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
