Reaction Details |
| Report a problem with these data |
Target | fMet-Leu-Phe receptor |
---|
Ligand | BDBM50513104 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1852058 (CHEMBL4352682) |
---|
EC50 | <100000±n/a nM |
---|
Citation | Deora, GS; Qin, CX; Vecchio, EA; Debono, AJ; Priebbenow, DL; Brady, RM; Beveridge, J; Teguh, SC; Deo, M; May, LT; Krippner, G; Ritchie, RH; Baell, JB Substituted Pyridazin-3(2 H)-ones as Highly Potent and Biased Formyl Peptide Receptor Agonists. J Med Chem62:5242-5248 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
fMet-Leu-Phe receptor |
---|
Name: | fMet-Leu-Phe receptor |
Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 38456.14 |
Organism: | Homo sapiens (Human) |
Description: | gi_4503779 |
Residue: | 350 |
Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
BDBM50513104 |
---|
n/a |
---|
Name | BDBM50513104 |
Synonyms: | CHEMBL4456812 |
Type | Small organic molecule |
Emp. Form. | C22H22FN3O3 |
Mol. Mass. | 395.4268 |
SMILES | COc1cccc(Cc2cc(C)nn(C(C)C(=O)Nc3ccccc3F)c2=O)c1 |
Structure |
|