| Reaction Details |
|---|
 | Report a problem with these data |
| Target | fMet-Leu-Phe receptor |
|---|
| Ligand | BDBM50513093 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1852058 (CHEMBL4352682) |
|---|
| EC50 | <100000±n/a nM |
|---|
| Citation |  Deora, GS; Qin, CX; Vecchio, EA; Debono, AJ; Priebbenow, DL; Brady, RM; Beveridge, J; Teguh, SC; Deo, M; May, LT; Krippner, G; Ritchie, RH; Baell, JB Substituted Pyridazin-3(2 H)-ones as Highly Potent and Biased Formyl Peptide Receptor Agonists. J Med Chem62:5242-5248 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| fMet-Leu-Phe receptor |
|---|
| Name: | fMet-Leu-Phe receptor |
|---|
| Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38456.14 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_4503779 |
|---|
| Residue: | 350 |
|---|
| Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
|---|
| BDBM50513093 |
|---|
| n/a |
|---|
| Name | BDBM50513093 |
|---|
| Synonyms: | CHEMBL4581644 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28BrN3O3 |
|---|
| Mol. Mass. | 498.412 |
|---|
| SMILES | CCCCC(C(=O)Nc1ccc(Br)cc1)n1nc(C)cc(Cc2ccccc2OC)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
